FMO2 polyclonal, anti-human

Quantity: 100 µg

Background:
Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene. This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.

Description:
Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 2 (FMO2) detection. Tested with WB in Human.

Synonyms:
2310008D08Rik antibody, 2310042I22Rik antibody, AW107733 antibody, Dimethylaniline monooxygenase [N oxide forming] 2 antibody, Dimethylaniline monooxygenase [N-oxide-forming] 2 antibody, Dimethylaniline oxidase 2 antibody, Flavin containing monooxygenase 2 (non functional) antibody, Flavin containing monooxygenase 2 antibody, FLJ40826 antibody, FMO 1B1 antibody, FMO 2 antibody, FMO antibody, FMO pulmonary antibody, FMO1B1 antibody, FMO2 antibody, FMO2_HUMAN antibody, MGC28212 antibody, OTTMUSP00000028686 antibody, OTTMUSP00000028687 antibody, Pulmonary flavin containing monooxygenase 2 antibody, Pulmonary flavin-containing monooxygenase 2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human FMO2 (78-115aa FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK), different from the related mouse and rat sequences by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.