FMO3 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12276
Catalog Number: AC-ABO12276
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 3(FMO3) detection. Tested with WB in Human;Mouse;Rat.
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 3
Protein Function:
Involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. Plays an important role in the metabolism of trimethylamine (TMA), via the production of TMA N-oxide (TMAO). Is also able to perform S-oxidation when acting on sulfide compounds (PubMed:9224773). .
Other Names: Dimethylaniline monooxygenase [N-oxide-forming] 3, 1.14.13.8, Dimethylaniline oxidase 3, FMO II, FMO form 2, Hepatic flavin-containing monooxygenase 3, FMO 3, Trimethylamine monooxygenase, 1.14.13.148, FMO3
Subcellular Localization: Microsome membrane. Endoplasmic reticulum membrane.
Tissue Specificity: Liver.
Gene ID: 2328
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO3 (404-433aa DMMNDINEKMEKKRKWFGKSETIQTDYIVY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
Calculated MW: 60033
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 3
Protein Function:
Involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. Plays an important role in the metabolism of trimethylamine (TMA), via the production of TMA N-oxide (TMAO). Is also able to perform S-oxidation when acting on sulfide compounds (PubMed:9224773). .
Other Names: Dimethylaniline monooxygenase [N-oxide-forming] 3, 1.14.13.8, Dimethylaniline oxidase 3, FMO II, FMO form 2, Hepatic flavin-containing monooxygenase 3, FMO 3, Trimethylamine monooxygenase, 1.14.13.148, FMO3
Subcellular Localization: Microsome membrane. Endoplasmic reticulum membrane.
Tissue Specificity: Liver.
Gene ID: 2328
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO3 (404-433aa DMMNDINEKMEKKRKWFGKSETIQTDYIVY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
Calculated MW: 60033
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review