FMO3 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
FMO3 (Flavin-containing Monooxygenase 3) is an enzyme that in humans is encoded by the FMO3 gene. The mammalian flavin-containing monooxygenases (FMO) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. The FMO3 gene contains 1 noncoding and 8 coding exons. And the FMO3 gene is mapped on 1q24.3. Using quantitative RNase protection assays, FMO3 is present in low abundance in fetal liver and lung and in adult kidney and lung, and in much greater abundance in adult liver. By Western blot analysis of human liver microsomal samples ranging from 8 weeks gestation to 18 years of age, FMO1 is the major fetal isoform and FMO3 is the major adult isoform. FMO3 was expressed at intermediate levels until 11 years of age when a gender-independent increase in FMO3 expression was observed during puberty. Sufferers of trimethylaminuria may display a reduced ability to metabolize substrates for FMO3 such as nicotine. FMO3 metabolizes a number of drugs, including amphetamine, clozapine, deprenyl, metamphetamine, tamoxifen, ethionamide, thiacetazone, and sulindac sulfide.

Description:
Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 3 (FMO3) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
Dimethylaniline monooxygenase [N oxide forming] 3 antibody, Dimethylaniline monooxygenase [N-oxide-forming] 3 antibody, Dimethylaniline monooxygenase 3 antibody, Dimethylaniline oxidase 3 antibody, dJ127D3.1 antibody, Flavin containing monooxygenase 3 antibody, FMO 3 antibody, FMO form 2 antibody, FMO II antibody, FMO3 antibody, FMO3_HUMAN antibody, FMOII antibody, Hepatic flavin containing monooxygenase 3 antibody, Hepatic flavin-containing monooxygenase 3 antibody, MGC34400 antibody, TMAU antibody, Trimethylamine monooxygenase antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human FMO3 (404-433aa DMMNDINEKMEKKRKWFGKSETIQTDYIVY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.