FOXA3 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12491
Catalog Number: AC-ABO12491
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Hepatocyte nuclear factor 3-gamma
Protein Function:
Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites (By similarity). Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis. .
Other Names: Hepatocyte nuclear factor 3-gamma, HNF-3-gamma, HNF-3G, Fork head-related protein FKH H3, Forkhead box protein A3, Transcription factor 3G, TCF-3G, FOXA3, HNF3G, TCF3G
Subcellular Localization: Nucleus .
Tissue Specificity: Expressed in erythroleukemia and hepatoma cell lines and in liver and pancreas. Not expressed in any other cell lines or tissues examined. .
Gene ID: 3171
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.
Calculated MW: 37140
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites (By similarity). Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis. .
Other Names: Hepatocyte nuclear factor 3-gamma, HNF-3-gamma, HNF-3G, Fork head-related protein FKH H3, Forkhead box protein A3, Transcription factor 3G, TCF-3G, FOXA3, HNF3G, TCF3G
Subcellular Localization: Nucleus .
Tissue Specificity: Expressed in erythroleukemia and hepatoma cell lines and in liver and pancreas. Not expressed in any other cell lines or tissues examined. .
Gene ID: 3171
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.
Calculated MW: 37140
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review