FOXA3 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.

Description:
Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma (FOXA3) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
FKHH3 antibody, Fork head-related protein FKH H3 antibody, forkhead box A3 antibody, Forkhead box protein A3 antibody, Foxa3 antibody, FOXA3_HUMAN antibody, hepatic nuclear factor-3-beta antibody, hepatocyte nuclear factor 3 antibody, hepatocyte nuclear factor 3 gamma antibody, Hepatocyte nuclear factor 3-gamma antibody, HNF-3-gamma antibody, HNF-3G antibody, HNF3B antibody, HNF3G antibody, TCF-3G antibody, TCF3G antibody, Transcription factor 3G antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.