FUT1 Picoband polyclonal, anti-human, mouse, rat

FUT1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12279
Catalog Number: AC-ABO12279
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1(FUT1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Protein Name: Galactoside 2-alpha-L-fucosyltransferase 1

Protein Function:
Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values.

Other Names: Galactoside 2-alpha-L-fucosyltransferase 1, 2.4.1.69, Alpha(1,2)FT 1, Blood group H alpha 2-fucosyltransferase, Fucosyltransferase 1, GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1, FUT1, H, HSC

Subcellular Localization: Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Membrane-bound form in trans cisternae of Golgi.

Gene ID: 2523

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids.

Calculated MW: 41251

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:FUT1 Picoband polyclonal, anti-human, mouse, rat