FUT1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.

Description:
Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1 (FUT1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
2)FT 1 antibody, 2-alpha-L-fucosyltransferase antibody, Alpha (1 2) fucosyltransferase antibody, Alpha(1 2)FT 1 antibody, Alpha(1 antibody, Blood group H alpha 2-fucosyltransferase antibody, fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase) antibody, Fucosyltransferase 1 antibody, FUT1 antibody, FUT1_HUMAN antibody, Galactoside 2 alpha L fucosyltransferase antibody, Galactoside 2-alpha-L-fucosyltransferase 1 antibody, GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1 antibody, H antibody, HH antibody, HSC antibody, Para Bombay phenotype antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.