Fyn polyclonal, anti-human
€384.00
In stock
SKU
ARP-10-P9197
Quantity: 100 µg
Background:
Proto-oncogene tyrosine-protein kinase Fyn, also known as SYN or SLK, is an enzyme that in humans is encoded by the FYN gene. It is mapped to 6q21. This gene is a member of the protein-tyrosine kinase oncogene family. FYN is a protein, present in the signaling pathway of integrins, which activates ras. It is primarily localized to the cytoplasmic leaflet of the plasma membrane, where it phosphorylates tyrosine residues on key targets involved in a variety of different signaling pathways. Tyrosine phosphorylation of target proteins by FYN serves to either regulate target protein activity, and/or to generate a binding site on the target protein that recruits other signaling molecules.
Description:
Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Fyn (FYN) detection. Tested with WB in Human.
Synonyms:
C syn protooncogene antibody, Fyn antibody, FYN oncogene related to SRC FGR YES antibody, FYN_HUMAN antibody, MGC45350 antibody, OKT3 induced calcium influx regulator antibody, P59 FYN antibody, p59-Fyn antibody, Protein tyrosine kinase fyn antibody, Proto oncogene tyrosine protein kinase fyn antibody, Proto-oncogene c-Fyn antibody, Proto-oncogene Syn antibody, Protooncogene Syn antibody, SLK antibody, Src like kinase antibody, Src yes related novel gene antibody, Src-like kinase antibody, Src/yes related novel antibody, Src/yes related novel gene antibody, SYN antibody, Tyrosine kinase p59fyn T antibody, Tyrosine kinase p59fyn(T) antibody, Tyrosine-protein kinase Fyn antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human Fyn(222-255aa ETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTD), identical to the related mouse and rat sequences.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human
Applications: WB
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review