GAB1 Picoband polyclonal, anti-human, rat

Description: Rabbit IgG polyclonal antibody for GRB2-associated-binding protein 1(GAB1) detection. Tested with WB in Human;Rat.Protein Name: GRB2-associated-binding protein 1

Protein Function:
Adapter protein that plays a role in intracellular signaling cascades triggered by activated receptor-type kinases. Plays a role in FGFR1 signaling. Probably involved in signaling by the epidermal growth factor receptor (EGFR) and the insulin receptor (INSR).

Other Names: GRB2-associated-binding protein 1, GRB2-associated binder 1, Growth factor receptor bound protein 2-associated protein 1, GAB1

Gene ID: 2549

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GAB1 (72-109aa LTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVR), different from the related mouse sequence by one amino acid.

Calculated MW: 76616

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.