GAD65 Picoband polyclonal, anti-human, mouse, rat

GAD65 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10278
Catalog Number: AC-ABO10278
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Glutamate decarboxylase 2

Protein Function:
Catalyzes the production of GABA.

Other Names: Glutamate decarboxylase 2, 4.1.1.15, 65 kDa glutamic acid decarboxylase, GAD-65, Glutamate decarboxylase 65 kDa isoform, GAD2, GAD65

Subcellular Localization: Cytoplasm, cytosol . Cytoplasmic vesicle . Cell junction, synapse, presynaptic cell membrane ; Lipid-anchor . Golgi apparatus membrane ; Peripheral membrane protein ; Cytoplasmic side . Associated to cytoplasmic vesicles. In neurons, cytosolic leaflet of Golgi membranes and presynaptic clusters.

Gene ID: 2572

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.

Calculated MW: 65411

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:GAD65 Picoband polyclonal, anti-human, mouse, rat