Galactosidase alpha Picoband polyclonal, anti-mouse

Galactosidase alpha Picoband polyclonal, anti-mouse

€455.00
In stock
SKU
AC-ABO10155
Catalog Number: AC-ABO10155
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection. Tested with WB in mouse.Protein Name: Alpha-galactosidase A

Other Names: Alpha-galactosidase A, 3.2.1.22, Alpha-D-galactosidase A, Alpha-D-galactoside galactohydrolase, Melibiase, Gla, Ags

Subcellular Localization: Lysosome.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids.

Calculated MW: 47643

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Galactosidase alpha Picoband polyclonal, anti-mouse