Galectin-4 Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12637
Catalog Number: AC-ABO12637
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Galectin-4(LGALS4) detection. Tested with WB in Human.Protein Name: Galectin-4
Protein Function:
Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
Other Names: Galectin-4, Gal-4, Antigen NY-CO-27, L-36 lactose-binding protein, L36LBP, Lactose-binding lectin 4, LGALS4
Gene ID: 3960
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY), different from the related mouse and rat sequences by seven amino acids.
Calculated MW: 35941
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
Other Names: Galectin-4, Gal-4, Antigen NY-CO-27, L-36 lactose-binding protein, L36LBP, Lactose-binding lectin 4, LGALS4
Gene ID: 3960
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY), different from the related mouse and rat sequences by seven amino acids.
Calculated MW: 35941
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review