Galectin 8 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.

Description:
Rabbit IgG polyclonal antibody for Galectin-8 (LGALS8) detection. Tested with WB in Human, Rat.

Synonyms:
Gal 8 antibody, Gal-8 antibody, Gal8 antibody, Galectin-8 antibody, galectin-8g antibody, Lectin galactoside binding soluble 8 antibody, LEG8_HUMAN antibody, LGAL S8 antibody, Lgals8 antibody, PCTA 1 antibody, PCTA-1 antibody, PCTA1 antibody, Po66 carbohydrate binding protein antibody, Po66 carbohydrate-binding protein antibody, Po66 CBP antibody, Po66-CBP antibody, Prostate carcinoma tumor antigen 1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.