galectin 9 polyclonal, anti-rat, human

Quantity: 100 µg

Background:
Galectin-9 is a protein that in humans is encoded by the LGALS9 gene. It is mapped to 17q11.2. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and / or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for galectin 9 (LGALS9) detection. Tested with WB in Human, Rat.

Synonyms:
Ecalectin antibody, Gal-9 antibody, Galectin-9 antibody, galectin9 antibody, HOM HD 21 antibody, HOMHD21 antibody, HUAT antibody, Lectin galactoside binding soluble 9 antibody, LEG9_HUMAN antibody, LGAL S9 antibody, LGALS 9 antibody, Lgals9 antibody, LGALS9A antibody, MGC117375 antibody, MGC125973 antibody, MGC125974 antibody, Tumor antigen HOM-HD-21 antibody, Urate transporter/channel protein antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human galectin 9 (322-355aa DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human galectin 9 (322-355aa DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: rat.
Predicted to work with: human.

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.