Retinol Binding Protein human active recombinant protein

Protein Family: Chaperones and Folding Catalysts

Pathway and Disease: Endocrine System

Alternate Names: Retinol Binding Protein, Plasma retinol binding protein 4 (RBP4), Interstitial retinol binding protein 4, RBPDescription:
Retinol binding protein (RBP) belongs to the lipocalin superfamily of proteins. RBP is synthesized and secreted by hepatic paraenchymal cells and is involved in the binding of retinol and transthyretin, preventing loss by glomerular filtration and renal excretion before transport to the peripheral tissues. Increased plasma levels of retinol binding protein have been shown to cause systemic insulin resistance, suggesting the protein plays a role in the pathogenesis of Type II diabetes. Recombinant RBP comprises a 183 amino acid fragment (19-201) corresponding to the mature RBP and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P02753

MW: 25.57 kDa

Sequence:
His-Tag sequence not included: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.