12 Lipoxygenase Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10239
Catalog Number: AC-ABO10239
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Arachidonate 12-lipoxygenase, 12S-type(ALOX12) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Arachidonate 12-lipoxygenase, 12S-type
Protein Function:
Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Mainly converts arachidonic acid to (12S)- hydroperoxyeicosatetraenoic acid/(12S)-HPETE but can also metabolize linoleic acid. Has a dual activity since it also converts leukotriene A4/LTA4 into both the bioactive lipoxin A4/LXA4 and lipoxin B4/LXB4. Through the production of specific bioactive lipids like (12S)-HPETE it regulates different biological processes including platelet activation. It also probably positively regulates angiogenesis through regulation of the expression of the vascular endothelial growth factor. Plays a role in apoptotic process, promoting the survival of vascular smooth muscle cells for instance. May also play a role in the control of cell migration and proliferation. .
Other Names: Arachidonate 12-lipoxygenase, 12S-type, 12S-LOX, 12S-lipoxygenase, 1.13.11.31, Lipoxin synthase 12-LO, 3.3.2.-, Platelet-type lipoxygenase 12, ALOX12, 12LO, LOG12
Subcellular Localization: Cytoplasm, cytosol. Membrane. Membrane association is stimulated by EGF.
Tissue Specificity: Expressed in vascular smooth muscle cells. .
Gene ID: 239
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven
Calculated MW: 75694
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Mainly converts arachidonic acid to (12S)- hydroperoxyeicosatetraenoic acid/(12S)-HPETE but can also metabolize linoleic acid. Has a dual activity since it also converts leukotriene A4/LTA4 into both the bioactive lipoxin A4/LXA4 and lipoxin B4/LXB4. Through the production of specific bioactive lipids like (12S)-HPETE it regulates different biological processes including platelet activation. It also probably positively regulates angiogenesis through regulation of the expression of the vascular endothelial growth factor. Plays a role in apoptotic process, promoting the survival of vascular smooth muscle cells for instance. May also play a role in the control of cell migration and proliferation. .
Other Names: Arachidonate 12-lipoxygenase, 12S-type, 12S-LOX, 12S-lipoxygenase, 1.13.11.31, Lipoxin synthase 12-LO, 3.3.2.-, Platelet-type lipoxygenase 12, ALOX12, 12LO, LOG12
Subcellular Localization: Cytoplasm, cytosol. Membrane. Membrane association is stimulated by EGF.
Tissue Specificity: Expressed in vascular smooth muscle cells. .
Gene ID: 239
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven
Calculated MW: 75694
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review