ACTH [1-39] Peptide
€279.00
In stock
SKU
350024
Protein Family: Hormones
Pathway and Disease: Carbohydrate Metabolism, Endocrine System, Signaling Molecules and Interaction
Alternate Names: Adrenocorticotropic hormone; ACTH; corticotropin
Accession No.: P01189
Description:
Adrenocorticotropic hormone (ACTH), also known as corticotropin, is produced and secreted by the anterior pituitary gland. ACTH is an important component of the hypothalamic-pituitary-adrenal axis as a response to biological stress. ACTH secretion is triggered by the corticotropin-releasing hormone (CRH) released from the hypothalamus, and stimulates the adrenal glands to release corticosteroids such as cortisol. ACTH [1-39] corresponds to full-length ACTH. ACTH [1-24] is conserved across species and is 75% as potent as ACTH. ACTH [1-10] has no ACTH activity but alter blood pressure. ACTH [4-10] has neurological effects.
Format:
Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.
MW: 4541.1 g/mol
Sequence:
Human: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH or H-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH
Composition:
C207H308N56O58S1
Purity:
> 95% by HPLC
Solubility:
Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile.
Storage:
Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C.
Pathway and Disease: Carbohydrate Metabolism, Endocrine System, Signaling Molecules and Interaction
Alternate Names: Adrenocorticotropic hormone; ACTH; corticotropin
Accession No.: P01189
Description:
Adrenocorticotropic hormone (ACTH), also known as corticotropin, is produced and secreted by the anterior pituitary gland. ACTH is an important component of the hypothalamic-pituitary-adrenal axis as a response to biological stress. ACTH secretion is triggered by the corticotropin-releasing hormone (CRH) released from the hypothalamus, and stimulates the adrenal glands to release corticosteroids such as cortisol. ACTH [1-39] corresponds to full-length ACTH. ACTH [1-24] is conserved across species and is 75% as potent as ACTH. ACTH [1-10] has no ACTH activity but alter blood pressure. ACTH [4-10] has neurological effects.
Format:
Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.
MW: 4541.1 g/mol
Sequence:
Human: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH or H-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH
Composition:
C207H308N56O58S1
Purity:
> 95% by HPLC
Solubility:
Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile.
Storage:
Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C.
| Is Featured? | No |
|---|
Write Your Own Review