Amylin Peptide (Rat)
€328.00
In stock
SKU
350048
Protein Family: Proteoglycans
Pathway and Disease: Metabolic Disorders
Alternate Names: Islet amyloid polypeptide; Amylin; Diabetes-associated peptide; DAP; Insulinoma amyloid peptide; IAPP
Accession No.: P12969
Description:
Amylin, also called Islet or insulinoma amyloid polypeptide (IAPP), is a 37-amino acid monomeric polypeptide isolated from pancreatic amyloid, which is commonly found in the islet of patients with diabetes mellitus type II and in insulinomas. Amylin is derived from a larger propeptide precursor of 89 amino acids in humans. Immunostaining of amylin is found in islet amyloid and in cells of the islets of Langherans, where it colocalizes with insulin in islet B cells.
Format:
Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.
MW: 3918.47 g/mol
Sequence:
Rat: H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Cys2-Cys7) or H-KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Cys2-Cys7)
Composition:
C167H270N52O53S2
Purity:
> 95% by HPLC
Solubility:
Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile.
Storage:
Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C.
Pathway and Disease: Metabolic Disorders
Alternate Names: Islet amyloid polypeptide; Amylin; Diabetes-associated peptide; DAP; Insulinoma amyloid peptide; IAPP
Accession No.: P12969
Description:
Amylin, also called Islet or insulinoma amyloid polypeptide (IAPP), is a 37-amino acid monomeric polypeptide isolated from pancreatic amyloid, which is commonly found in the islet of patients with diabetes mellitus type II and in insulinomas. Amylin is derived from a larger propeptide precursor of 89 amino acids in humans. Immunostaining of amylin is found in islet amyloid and in cells of the islets of Langherans, where it colocalizes with insulin in islet B cells.
Format:
Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.
MW: 3918.47 g/mol
Sequence:
Rat: H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Cys2-Cys7) or H-KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Cys2-Cys7)
Composition:
C167H270N52O53S2
Purity:
> 95% by HPLC
Solubility:
Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile.
Storage:
Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C.
| Is Featured? | No |
|---|
Write Your Own Review