IL-12 beta human active recombinant protein

IL-12 beta human active recombinant protein

€295.00
In stock
SKU
600264
Catalog Number: 600264
Size: 0.01 mg
Datasheet
Request Information
Protein Family: Cytokines

Pathway and Disease: Signaling Molecules and Interaction, Signal Transduction, Infectious Diseases, Immune System

Alternate Names: IL-12 beta, Interleukin-12 subunit beta, IL-12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit, CLMF p40, IL-12 subunit p40, NK cell stimulatory factor chain 2, NKSF2Description:
Interleukin-12 beta (IL-12 beta) is a cytokine that can act as a growth factor for activated T and NK cells. IL-12 beta enhances the lytic activity of NK/lymphokine-activated killer cells, and stimulates the production of IFN-gamma by resting PBMC. IL-12 beta associates with IL23A to form IL-23, a heterodimeric cytokine which functions in innate and adaptive immunity. Defects in IL12 beta are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. Recombinant IL-12 beta comprises a 306 amino acid fragment (23-328) corresponding to the mature IL-12 beta chain and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P29460

MW: 39.02 kDa

Sequence:
His-Tag sequence not included: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:IL-12 beta human active recombinant protein