IL-33 human active recombinant protein
€295.00
In stock
SKU
600268
Protein Family: Cytokines
Pathway and Disease: Signaling Molecules and Interaction, Signal Transduction, Infectious Diseases, Immune System
Alternate Names: IL-33, IL-33, Nuclear factor from High Endothelial Venules, NFHEV, Chromosome 9 open reading frame 26, CRORF26, Interleukin-1 family member 11, IL1F11.Description:
Interleukin 33 (IL-33) is a proimflammatory cytokine belonging to the IL-1 family. IL-33 is cleaved intracellularly, generating an N terminal and a C terminal fragment. The C terminal fragment corresponds to the mature IL-33 protein and mediates its biological effect by interacting with the IL-1 receptor, also known as ST2. Binding of mature IL-33 to this receptor activates NF-kappa-B and MAP kinases and induces the production of associated cytokines, in particular IL-4, IL-5 and IL-13, causing severe pathological changes in mucosal organs. Recombinant interleukin-33 comprises a 159 amino acid fragment (112-270) corresponding to C terminal Interleukin-33 fragment and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: O95760
MW: 22.49 kDa
Sequence:
His-Tag sequence not included: SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
Pathway and Disease: Signaling Molecules and Interaction, Signal Transduction, Infectious Diseases, Immune System
Alternate Names: IL-33, IL-33, Nuclear factor from High Endothelial Venules, NFHEV, Chromosome 9 open reading frame 26, CRORF26, Interleukin-1 family member 11, IL1F11.Description:
Interleukin 33 (IL-33) is a proimflammatory cytokine belonging to the IL-1 family. IL-33 is cleaved intracellularly, generating an N terminal and a C terminal fragment. The C terminal fragment corresponds to the mature IL-33 protein and mediates its biological effect by interacting with the IL-1 receptor, also known as ST2. Binding of mature IL-33 to this receptor activates NF-kappa-B and MAP kinases and induces the production of associated cytokines, in particular IL-4, IL-5 and IL-13, causing severe pathological changes in mucosal organs. Recombinant interleukin-33 comprises a 159 amino acid fragment (112-270) corresponding to C terminal Interleukin-33 fragment and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: O95760
MW: 22.49 kDa
Sequence:
His-Tag sequence not included: SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
| Is Featured? | No |
|---|
Write Your Own Review