IL-35 human active recombinant protein

IL-35 human active recombinant protein

€295.00
In stock
SKU
600343
Catalog Number: 600343
Size: 0.01 mg
Datasheet
Request Information
Protein Family: Cytokines

Pathway and Disease: Cancers, Cell Growth and Death, Immune System, Signaling Molecules and Interaction

Alternate Names: IL-35, IL35, Interleukin-35, Interleukin 35Description:
Interleukin 35 (IL-35) is a member of IL-12 cytokine family and is produced by regulatory T-cells (Tregs). This heterodimeric cytokine is comprised of one p35 subunit (also a subunit of IL-12) and one EBI3 subunit (also a subunit of IL-27). IL-35 signals through IL-12Rbeta2 and gp130 heterodimers and homodimers to induce a suppression of inflammatory responses. Human IL-35 is produced in HEK 293. Recombinant human IL-35 is a single chain product, containing 442 amino acids, with a predicted molecular weight of 49 kDa (observed molecular weight of approximately 75-95 KDa reduced and approximately 65-75 kDa unreduced). From N terminus to C terminus, the molecule is comprised of a poly His tag, the EBI3 subunit, a G rich linker and the p35 subunit.

Source: HEK293 cells. Endotoxin level as measured by LAL is <0.05ng/ug or <0.5EU/ug.

Applications: E, WB

Application Notes:
There is no biological assay data available at this time.

Accession No.: Q14213/P29459

MW: 49000 Da

Sequence:
EBI3:RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Purity:
Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.

Format:
Each vial contains 10 ug of lyophilized protein. Reconstitute with 0.1 ml sterile deionized water for a final concentration of 0.1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:IL-35 human active recombinant protein