IL-8 human active recombinant protein
€295.00
In stock
SKU
600271
Protein Family: Cytokines
Pathway and Disease: Signaling Molecules and Interaction, Signal Transduction, Infectious Diseases, Immune System
Alternate Names: IL-8, IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte derived neutrophil activating peptide, MONAP, EmoctakinDescription:
Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. IL-8 is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells, and fibroblasts in response to an inflammatory stimulus. IL-8 also acts by recruiting neutrophils, T-cells, and basophils to the site of inflammation. Recombinant IL-8 comprises the 77 amino acid fragment (23-99) corresponding to the mature IL-8 protein and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: P10145
MW: 13.7 kDa
Sequence:
His-Tag sequence not included: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
Pathway and Disease: Signaling Molecules and Interaction, Signal Transduction, Infectious Diseases, Immune System
Alternate Names: IL-8, IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte derived neutrophil activating peptide, MONAP, EmoctakinDescription:
Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. IL-8 is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells, and fibroblasts in response to an inflammatory stimulus. IL-8 also acts by recruiting neutrophils, T-cells, and basophils to the site of inflammation. Recombinant IL-8 comprises the 77 amino acid fragment (23-99) corresponding to the mature IL-8 protein and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: P10145
MW: 13.7 kDa
Sequence:
His-Tag sequence not included: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
| Is Featured? | No |
|---|
Write Your Own Review