Inhibin Alpha human active recombinant protein

Inhibin Alpha human active recombinant protein

€295.00
In stock
SKU
600256
Catalog Number: 600256
Size: 0.01 mg
Datasheet
Request Information
Protein Family: Cytokines

Pathway and Disease: Endocrine System

Alternate Names: Inhibin alpha Subunit, Inhibin alpha chain Description:
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, and embryonic axial development or bone growth (depending on their subunit composition). Inhibins appear to oppose the functions of activins. Inhibins are dimeric proteins, linked by one or more disulfide bonds. Inhibin A is a dimer of alpha and beta-A. Inhibin B is a dimer of alpha and beta-B. Recombinant inhibin alpha subunit comprises a 134 amino acid fragment (233-366) corresponding to the mature inhibin alpha subunit protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P05111

MW: 19.20 kDa

Sequence:
His-Tag sequence not included: STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Inhibin Alpha human active recombinant protein