L-Selectin human active recombinant protein
€295.00
In stock
SKU
600273
Protein Family: Cell Adhesion Molecules, CAM Ligands, Glycan Binding Proteins, Cellular Antigens
Pathway and Disease: Signaling Molecules and Interaction
Alternate Names: L-Selectin, Leukocyte Selectin, L-SEL, Leukocyte adhesion molecule, LAM-1, Leukocyte cell adhesion molecule LECAM-1, TQ1, CD62L, Leukocyte surface antigen Leu-8, DREG, lymph node homing receptor LNHR, MEL-14Description:
L-Selectin belongs to a family of divalent cation dependent carbohydrate-binding glycoproteins or adhesion molecules. L-Selectin is expressed constitutively on lymphocytes, monocytes and granulocytes and interacts specifically with carbohydrate groups on activated endothelial cells. L-Selectin is shed by proteolytic cleavage and circulating levels in biological fluids are used as an indicator of various pathological conditions. Recombinant human L-selectin comprises a 294 amino acid fragment (39-332) corresponding to the mature L-Selectin extracellular domain and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: Q9UJ43
MW: 37.55 kDa
Sequence:
His-Tag sequence not included: WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEGENWGDGEPNNKKNREDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
Pathway and Disease: Signaling Molecules and Interaction
Alternate Names: L-Selectin, Leukocyte Selectin, L-SEL, Leukocyte adhesion molecule, LAM-1, Leukocyte cell adhesion molecule LECAM-1, TQ1, CD62L, Leukocyte surface antigen Leu-8, DREG, lymph node homing receptor LNHR, MEL-14Description:
L-Selectin belongs to a family of divalent cation dependent carbohydrate-binding glycoproteins or adhesion molecules. L-Selectin is expressed constitutively on lymphocytes, monocytes and granulocytes and interacts specifically with carbohydrate groups on activated endothelial cells. L-Selectin is shed by proteolytic cleavage and circulating levels in biological fluids are used as an indicator of various pathological conditions. Recombinant human L-selectin comprises a 294 amino acid fragment (39-332) corresponding to the mature L-Selectin extracellular domain and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: Q9UJ43
MW: 37.55 kDa
Sequence:
His-Tag sequence not included: WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEGENWGDGEPNNKKNREDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
| Is Featured? | No |
|---|
Write Your Own Review