PDGF-2 human active recombinant protein
€295.00
In stock
SKU
600286
Protein Family: CAM Ligands
Pathway and Disease: Signaling Molecules and Interaction, Cell Motility, Cell Communication, Cancers
Alternate Names: PDGF-2, Platelet-derived growth factor subunit B, PDGF subunit B, PDGF-2, Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide, Proto-oncogene c-SisDescription:
The term ‘PDGF’ refers to a family of disulphide bond linked dimeric isoforms that act as autocrine and paracrine growth factors and are released by platelets. They act as potent mitogens for almost all mesenchymally-derived cells. Aberrant expression is involved in certain cancers, fibroproliferative disorders, and atherosclerosis. PDGF proteins also contribute to wound healing and neural regeneration. There are four members of the PDGF family: PDGF A, PDGF B, PDGF C and PDGF D. Recombinant PDGF-B comprises a 109 amino acid fragment (82-190) corresponding to the mature PDGF-B chain protein and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: P01127
MW: 16.75 kDa
Sequence:
His-Tag sequence not included: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
Pathway and Disease: Signaling Molecules and Interaction, Cell Motility, Cell Communication, Cancers
Alternate Names: PDGF-2, Platelet-derived growth factor subunit B, PDGF subunit B, PDGF-2, Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide, Proto-oncogene c-SisDescription:
The term ‘PDGF’ refers to a family of disulphide bond linked dimeric isoforms that act as autocrine and paracrine growth factors and are released by platelets. They act as potent mitogens for almost all mesenchymally-derived cells. Aberrant expression is involved in certain cancers, fibroproliferative disorders, and atherosclerosis. PDGF proteins also contribute to wound healing and neural regeneration. There are four members of the PDGF family: PDGF A, PDGF B, PDGF C and PDGF D. Recombinant PDGF-B comprises a 109 amino acid fragment (82-190) corresponding to the mature PDGF-B chain protein and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: P01127
MW: 16.75 kDa
Sequence:
His-Tag sequence not included: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
| Is Featured? | No |
|---|
Write Your Own Review