PDGF-2 human active recombinant protein

PDGF-2 human active recombinant protein

€295.00
In stock
SKU
600286
Catalog Number: 600286
Size: 0.01 mg
Datasheet
Request Information
Protein Family: CAM Ligands

Pathway and Disease: Signaling Molecules and Interaction, Cell Motility, Cell Communication, Cancers

Alternate Names: PDGF-2, Platelet-derived growth factor subunit B, PDGF subunit B, PDGF-2, Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide, Proto-oncogene c-SisDescription:
The term ‘PDGF’ refers to a family of disulphide bond linked dimeric isoforms that act as autocrine and paracrine growth factors and are released by platelets. They act as potent mitogens for almost all mesenchymally-derived cells. Aberrant expression is involved in certain cancers, fibroproliferative disorders, and atherosclerosis. PDGF proteins also contribute to wound healing and neural regeneration. There are four members of the PDGF family: PDGF A, PDGF B, PDGF C and PDGF D. Recombinant PDGF-B comprises a 109 amino acid fragment (82-190) corresponding to the mature PDGF-B chain protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P01127

MW: 16.75 kDa

Sequence:
His-Tag sequence not included: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:PDGF-2 human active recombinant protein