Rantes human active recombinant protein

Protein Family: Cytokines

Pathway and Disease: Signaling Molecules and Interaction, Immune System, Neurodegenerative Disorders, Infectious Diseases

Alternate Names: Rantes, CCL5, Chemokine (C-C motif) ligand 5, T-cell specific RANTES protein, T-cell specific protein P288, beta chemokine RANTES precursor, small inducible cytokine A5, SIS delta, TCP288Description:
RANTES (acronym for Regulated upon Activation, Normal T-cell Expressed, and presumably Secreted) is a member of the beta (CC) chemokine subfamily and is predominantly produced from T cells and platelets. RANTES has been shown to be a chemoattractant factor for monocytes, CD4+/CD45RO+ T lymphocytes and basophils. It has also been shown to induce the proliferation and activation of killer cells and acts as a HIV suppressive factor. Recombinant RANTES comprises a 68 amino acid fragment (24-91) corresponding to the mature RANTES protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P13501

MW: 12.35 kDa

Sequence:
His-Tag sequence not included: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.