S-100 Beta human active recombinant protein

S-100 Beta human active recombinant protein

€295.00
In stock
SKU
600295
Catalog Number: 600295
Size: 0.01 mg
Datasheet
Request Information
Protein Family: Chaperones and Folding Catalysts

Pathway and Disease: Nervous and Sensory Systems, Cell Growth and Death

Alternate Names: S100 Beta Chain, NEF, S100, S100B, S-100 protein beta chain, S-100 calcium binding protein beta chain, S100 calcium binding protein beta (neural)Description:
S100 proteins belong to a family of EF-hand calcium binding proteins that exist mostly as dimers of the 20 currently identified individual S100 monomers. The S100 beta chain (S-100B) homodimer is expressed in cells of the central nervous system, glial cells, and in certain peripheral cells: Schwann cells, melanocytes, adipocytes and chondrocytes. The determination of S-100B in serum levels can be used to monitor the extent of brain injury and malignant melanoma. Recombinant S-100 beta comprises a 91 amino acid fragment (2-92) corresponding to processed S100 beta-chain and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P04271

MW: 14.71 kDa

Sequence:
His-Tag sequence not included: SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:S-100 Beta human active recombinant protein