TGF beta 1 human active recombinant protein

TGF beta 1 human active recombinant protein

€295.00
In stock
SKU
600304
Catalog Number: 600304
Size: 0.01 mg
Datasheet
Request Information
Protein Family: Chaperones and Folding Catalysts, CAM Ligands, Cytokines

Pathway and Disease: Immune System, Cell Growth and Death, Signal Transduction, Infectious Diseases, Signaling Molecules and Interaction, Cell Growth and Death, Endocrine System, Neurodegenerative Disorders

Alternate Names: TGF beta 1, Transforming growth factor beta-1, TGFb-1, TGFb, TGF beta 1, TGF-b1Description:
Transforming growth factor beta-1 (TGF beta 1) is a member of the larger TGF beta superfamily of cytokines produced by a wide variety of cells that are involved in the regulation of cell proliferation, differentiation, apoptosis, cellular homeostasis and a wide variety of other cellular functions. TGF beta 1 has been shown to regulate the actions of many other growth factors involved in a range of human diseases including renal disease, hepatic disease, heart failure and cardiomyopathies. Recombinant TGF beta 1 comprises a 112 amino acid fragment (279-390) corresponding to the mature TGF-beta protein sequence and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P01137

MW: 17.3 kDa

Sequence:
His-Tag sequence not included: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:TGF beta 1 human active recombinant protein