TIMP-1 human active recombinant protein

Protein Family: Cytokines

Pathway and Disease: Cell Growth and Death, Signaling Molecules and Interaction

Alternate Names: TIMP, CLGI, EPA, EPO, HCI, TIMP, Erythroid-potentiating Activity, tissue inhibitor of metalloprotease 1, collagenase inhibitor, metalloprotease inhibitor 1 precursor, tissue inhibitor of metalloproteases, Fibroblast collagenase inhibitorDescription:
Tissue inhibitor of metalloproteinase 1 (TIMP-1) is an inducible glycoprotein, which is synthesized by many different cell types. TIMP-1 binds in a reversible fashion to matrix metalloproteinases, with regions in the N-terminal domain binding to the MMP substrate-binding site. TIMP-1 stimulates erythropoiesis and inhibits apoptosis in B-cells. Recombinant TIMP-1 comprises a 184 amino acid fragment (24-207) corresponding to the mature TIMP-1 protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P01033

MW: 25.21 kDa

Sequence:
His-Tag sequence not included: CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.