TNF-R2 human active recombinant protein

TNF-R2 human active recombinant protein

€295.00
In stock
SKU
600300
Catalog Number: 600300
Size: 0.01 mg
Datasheet
Request Information
Protein Family: Cellular Antigens, Receptors and Channels

Pathway and Disease: ignal Transduction, Infectious Diseases, Signaling Molecules and Interaction, Cell Growth and Death, Endocrine System, Neurodegenerative Disorders

Alternate Names: TNF-R2, TNF-R2, Tumour necrosis factor receptor 2, Tumour receptor beta receptor, Tumour necrosis factor binding protein 2, Tumour necrosis factor receptor superfamily member 1B, Tumour necrosis factor receptor type II, p80 TNF alpha receptor, Etanercept, CD120b, p75, TBPII, TNFRII, TNFR75, TNFBR, TNFR2, TNFR80Description:
Two types of soluble TNF receptors (sTNF-R1 and sTNF-R2) have been identified which act to neutralize the biological activities of TNF alpha and TNF beta. Levels of these soluble receptors appear to arise as a result of shedding of the extracellular domains of the membrane bound receptors. Elevated levels of soluble TNF receptors have been found in the amniotic fluid of pregnant women. Recombinant sTNF-R2 comprises a 184 amino acid fragment (23-206) corresponding to the mature TNF-R2 protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P20333

MW: 24.45 kDa

Sequence:
His-Tag sequence not included: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:TNF-R2 human active recombinant protein