VCAM-1 [109-331] human active recombinant protein
€295.00
In stock
SKU
600309
Protein Family: Cell Adhesion Molecules, Cellular Antigens, CAM Ligands, Glycan Binding Proteins
Pathway and Disease: Signaling Molecules and Interaction, Immune System, Infectious Diseases
Alternate Names: VCAM-1, Vascular cell adhesion molecule 1, INCAM-100, Vascular cell adhesion protein 1 precursor, CD-106 antigen, VCAM-1, V-CAM 2Description:
Vascular Cell Adhesion Molecule-1 (VCAM-1) is a cell surface sialoglycoprotein expressed by cytokine activated endothelium. The protein has a number of functions including the regulation of leukocyte migration, leukocyte-endothelial cell adhesion and signal transduction, and plays a role in a number of inflammatory diseases. Recombinant VCAM-1 [109-331] comprises a 203 amino acid fragment (109-331) corresponding to the Ig-like C2 type domains 2 and 3 and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: P19320
MW: 26.99 kDa
Sequence:
His-Tag sequence not included: QVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKALVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEVELIVQEK
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
Pathway and Disease: Signaling Molecules and Interaction, Immune System, Infectious Diseases
Alternate Names: VCAM-1, Vascular cell adhesion molecule 1, INCAM-100, Vascular cell adhesion protein 1 precursor, CD-106 antigen, VCAM-1, V-CAM 2Description:
Vascular Cell Adhesion Molecule-1 (VCAM-1) is a cell surface sialoglycoprotein expressed by cytokine activated endothelium. The protein has a number of functions including the regulation of leukocyte migration, leukocyte-endothelial cell adhesion and signal transduction, and plays a role in a number of inflammatory diseases. Recombinant VCAM-1 [109-331] comprises a 203 amino acid fragment (109-331) corresponding to the Ig-like C2 type domains 2 and 3 and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: P19320
MW: 26.99 kDa
Sequence:
His-Tag sequence not included: QVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKALVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEVELIVQEK
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
| Is Featured? | No |
|---|
Write Your Own Review